PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400045557
Common NameLOC102593619
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 538aa    MW: 60083.2 Da    PI: 7.1722
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400045557genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.46.1e-16741135
                  GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                          C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  PGSC0003DMP400045557  7 CYHCGVTSTPLWRNGPPEKPILCNACGSRWRTKGT 41
                          ****************66666***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.7E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.66E-11546No hitNo description
CDDcd002021.23E-16654No hitNo description
Gene3DG3DSA:3.30.50.102.5E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF003209.8E-14741IPR000679Zinc finger, GATA-type
PfamPF139199.1E-11286367IPR028020ASX homology domain
PfamPF165501.8E-9299375IPR032368UCH-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPILCN ACGSRWRTKG TLVNYTPLHA RAEPDDLEDY  60
RVSRFKNFPV KNKEVKMLKR KKSHDIPEIG ILPEYHQGFH RKALDEDTSN RSSSGSAVSN  120
TESYGQFGSA EASDLTGPAQ SNIWDATVPS RKRTCVNRPK QSSVEKLTKD LYTILHEQQC  180
SYFSGSSEED LLLESDKPMV SVEIGHGSVL IRHPSSIGRE EESEASSLSV DNKHHSSNEA  240
YSQLTTPPVN ISKGVNSSNL VIQRTQKPTG QGVEHEQFKR SRDHLEKLQI LGHHNSPLCH  300
IDLKDVLNYE EFTRHLSSDE QQQLLKYLPP VDSFSPPESL RSMFESSQFE ENLSSFQKLL  360
AEGVFDNSLS GVTVEECRNL KRFMLCYLMK SKWVEQVNLL KDMKCKNSSS SSEVAGGSNV  420
FGTGHSVNMK RPRDGQHPKY LGVNTTMKSP KRVAMKNSYE QKEIMENDSS CFSPKSLFAL  480
PSENSFRFTN ESSDQDLLLD VPSNSSFPQA ELLLPTASFA AQASTSSSSI YPHLIHP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17883KRKKSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006359221.10.0PREDICTED: GATA transcription factor 26-like
SwissprotQ8W4H11e-148GAT26_ARATH; GATA transcription factor 26
TrEMBLM1CHE60.0M1CHE6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000675060.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20892462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-142GATA transcription factor 26
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]